Structure of PDB 7xms Chain R Binding Site BS01

Receptor Information

>7xms Chain R (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVAIQCIYALVCLVGLVGNALVIFVILRYAKMKTATNIYLLNLAVADELF
MLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYV
AVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAV
ACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAG
WQQRRRSEKKITRLVLMFVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVS
LILSYANSCANPILYGFLSDNFRRFF

Ligand information

>7xms Chain L (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CKNFFWKTFTSC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7xms Structural insights into ligand recognition and selectivity of somatostatin receptors.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	D126 M130 A190 N199 W202 T215 Q279 L283 T286 N293
Binding residue (residue number reindexed from 1)	D80 M84 A144 N153 W156 T169 Q233 L237 T240 N247

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0004994	somatostatin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xms, PDBe:7xms, PDBj:7xms
PDBsum	7xms
PubMed	35739238
UniProt	P31391\|SSR4_HUMAN Somatostatin receptor type 4 (Gene Name=SSTR4)

[Back to BioLiP]