Structure of PDB 7xmr Chain R Binding Site BS01

Receptor Information
>7xmr Chain R (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIA
DELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSI
DRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQW
GRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSS
GIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTP
ALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xmr Structural insights into ligand recognition and selectivity of somatostatin receptors.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q102 D122 Q126 R184 S192 T194 W197 Y205 F208 T212 F272 N276 S279 V280 K291 F294 Y302
Binding residue
(residue number reindexed from 1)		Q64 D84 Q88 R146 S154 T156 W159 Y167 F170 T174 F234 N238 S241 V242 K253 F256 Y264
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004994 somatostatin receptor activity
GO:0005515 protein binding
GO:0030165 PDZ domain binding
GO:0042923 neuropeptide binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007283 spermatogenesis
GO:0008285 negative regulation of cell population proliferation
GO:0021549 cerebellum development
GO:0030432 peristalsis
GO:0030900 forebrain development
GO:0038170 somatostatin signaling pathway
GO:0042594 response to starvation
GO:0071385 cellular response to glucocorticoid stimulus
GO:0071392 cellular response to estradiol stimulus
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043005 neuron projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7xmr, PDBe:7xmr, PDBj:7xmr
PDBsum7xmr
PubMed35739238
UniProtP30874|SSR2_HUMAN Somatostatin receptor type 2 (Gene Name=SSTR2)

[Back to BioLiP]