Structure of PDB 7x8x Chain R Binding Site BS01

Receptor Information
>7x8x Chain R (length=175) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINS
PGGSISAGMAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALP
HARILMHQPLGGVTGSAADIAIQAEQFAVIKKEMFRLNAEFTGQPIERIE
ADSDRDRWFTAAEALEYGFVDHIIT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7x8x structural insights into Mycobacterium tuberculosis ClpP1P2 inhibition by Cediranib: implications for developing antimicrobial agents targeting Clp protease
Resolution3.24 Å
Binding residue
(original residue number in PDB)		G69 I71 S98 M99 H123 P125 L126 G127 F143
Binding residue
(residue number reindexed from 1)		G53 I55 S82 M83 H107 P109 L110 G111 F127
Enzymatic activity
Enzyme Commision number 3.4.21.92: endopeptidase Clp.
Gene Ontology
Molecular Function
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7x8x, PDBe:7x8x, PDBj:7x8x
PDBsum7x8x
PubMed
UniProtP9WPC5|CLPP1_MYCTU ATP-dependent Clp protease proteolytic subunit 1 (Gene Name=clpP1)

[Back to BioLiP]