Structure of PDB 7wui Chain R Binding Site BS01

Receptor Information
>7wui Chain R (length=245) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QMMALTFITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALL
LLNLIFLLDSWIALYNTRGFCIAVAVFLHYFLLVSFTWMGLEAFHMYLAL
VKVFNTYIRKYILKFCIVGWGIPAVVVSIVLTISPDNYGIDFCWINSNVV
FYITVVGYFCVIFLLNVSMFIVVLVQLCRIKKKKQLGDLRSIAGLTFLLG
ITWGFAFFAWNVTFMYLFAIFNTLQGFFIFIFYCAAKENVRKQWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wui Tethered peptide activation mechanism of the adhesion GPCRs ADGRG2 and ADGRG4.
Resolution3.1 Å
Binding residue
(original residue number in PDB)
L620 T621 T624 C628 L667 L697 D768 F769 W771 S774 N775 F778 Y779 V782 F786 W838 A841 W845 F856 A857
Binding residue
(residue number reindexed from 1)
L5 T6 T9 C13 L52 L82 D141 F142 W144 S147 N148 F151 Y152 V155 F159 W203 A206 W210 F218 A219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0008218 bioluminescence
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7wui, PDBe:7wui, PDBj:7wui
PDBsum7wui
PubMed35418677
UniProtQ8CJ12|AGRG2_MOUSE Adhesion G-protein coupled receptor G2 (Gene Name=Adgrg2)

[Back to BioLiP]