Structure of PDB 7wq4 Chain R Binding Site BS01

Receptor Information
>7wq4 Chain R (length=282) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVAD
LCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL
DRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLAN
LTVCHPAWSAPRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVAGS
GARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRI
LSHLVSYANSCVNPIVYALVSKHFRKGFRTIC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wq4 Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D89 H102 L169 H176 P177 R184 F264 L266 T267 T270 Y271 R274
Binding residue
(residue number reindexed from 1)		D68 H81 L148 H155 P156 R163 F239 L241 T242 T245 Y246 R249
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004966 galanin receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0042923 neuropeptide binding
Biological Process
GO:0006936 muscle contraction
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007194 negative regulation of adenylate cyclase activity
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007218 neuropeptide signaling pathway
GO:0007611 learning or memory
GO:0007631 feeding behavior
GO:0031175 neuron projection development
GO:0043647 inositol phosphate metabolic process
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0046488 phosphatidylinositol metabolic process
GO:0090663 galanin-activated signaling pathway
GO:1902608 positive regulation of large conductance calcium-activated potassium channel activity
Cellular Component
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wq4, PDBe:7wq4, PDBj:7wq4
PDBsum7wq4
PubMed
UniProtO43603|GALR2_HUMAN Galanin receptor type 2 (Gene Name=GALR2)

[Back to BioLiP]