Structure of PDB 7wq3 Chain R Binding Site BS01

Receptor Information

>7wq3 Chain R (length=289) Species: 9606 (Homo sapiens)

ENFVTLVVFGLIFALGVLGNSLVITVLARSKPGKPRSTTNLFILNLSIAD
LAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSV
DRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRA
SNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCYAKVLNHLHKKL
KNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPAS
FLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKC

Ligand information

>7wq3 Chain L (length=16) Species: 9606 (Homo sapiens)

GWTLNSAGYLLGPHAV

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7wq3 Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): E32 V95 H112 F186 W188 Q190 F275 L277 F282 R285
• Binding residue (residue number reindexed from 1): E1 V64 H81 F155 W157 Q159 F244 L246 F251 R254

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004966 galanin receptor activity
• GO:0005515 protein binding
• GO:0008528 G protein-coupled peptide receptor activity
• GO:0017046 peptide hormone binding
• GO:0042923 neuropeptide binding

Biological Process

• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
• GO:0007194 negative regulation of adenylate cyclase activity
• GO:0007204 positive regulation of cytosolic calcium ion concentration
• GO:0007218 neuropeptide signaling pathway
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051464 positive regulation of cortisol secretion

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:7wq3, PDBe:7wq3, PDBj:7wq3
• PDBsum: 7wq3
• UniProt: P47211|GALR1_HUMAN Galanin receptor type 1 (Gene Name=GALR1)