Structure of PDB 7w59 Chain R Binding Site BS01

Receptor Information
>7w59 Chain R (length=280) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDA
IARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVA
LEKSVSQKVAAAMPKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKD
PMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWK
NAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMR
AQVERKMAQKEKEKHEEKLREMAQKARERR
Ligand information
>7w59 Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu
<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w59 Mechanism of exon ligation by human spliceosome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
P219 N256
Binding residue
(residue number reindexed from 1)
P164 N201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0003723 RNA binding
GO:0005112 Notch binding
GO:0005515 protein binding
GO:0016922 nuclear receptor binding
GO:0019899 enzyme binding
GO:0042809 nuclear vitamin D receptor binding
GO:0042974 nuclear retinoic acid receptor binding
GO:0046332 SMAD binding
GO:0050681 nuclear androgen receptor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0000398 mRNA splicing, via spliceosome
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030511 positive regulation of transforming growth factor beta receptor signaling pathway
GO:0042771 intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043923 positive regulation by host of viral transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0048026 positive regulation of mRNA splicing, via spliceosome
GO:0048384 retinoic acid receptor signaling pathway
GO:0048385 regulation of retinoic acid receptor signaling pathway
GO:0050769 positive regulation of neurogenesis
GO:0070562 regulation of vitamin D receptor signaling pathway
GO:0070564 positive regulation of vitamin D receptor signaling pathway
GO:0071300 cellular response to retinoic acid
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0008024 cyclin/CDK positive transcription elongation factor complex
GO:0016363 nuclear matrix
GO:0016604 nuclear body
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7w59, PDBe:7w59, PDBj:7w59
PDBsum7w59
PubMed35705093
UniProtQ13573|SNW1_HUMAN SNW domain-containing protein 1 (Gene Name=SNW1)

[Back to BioLiP]