Structure of PDB 7w56 Chain R Binding Site BS01

Receptor Information
>7w56 Chain R (length=276) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LFMPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLL
VLLVGLPLELYEMWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVE
RYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVP
CRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRL
RRERRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVDGLHLAFQHVHVIS
GIFFYLGSAANPVLYSLMSSRFRETF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w56 Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		E117 E120 M121 N124 T138 F141 N196 H200 C219 Y228 F313 W320 H331 H338 G342
Binding residue
(residue number reindexed from 1)		E59 E62 M63 N66 T80 F83 N138 H142 C161 Y170 F226 W233 H240 H247 G251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001607 neuromedin U receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0005506 iron ion binding
GO:0008188 neuropeptide receptor activity
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0042924 neuromedin U binding
GO:0046872 metal ion binding
Biological Process
GO:0006821 chloride transport
GO:0006939 smooth muscle contraction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0019722 calcium-mediated signaling
GO:0022900 electron transport chain
GO:0050850 positive regulation of calcium-mediated signaling
Cellular Component
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w56, PDBe:7w56, PDBj:7w56
PDBsum7w56
PubMed35440625
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
Q9HB89

[Back to BioLiP]