Structure of PDB 7w55 Chain R Binding Site BS01

Receptor Information
>7w55 Chain R (length=303) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHFFLPVSVVYVPIFVVGVIGNVLVCLVILQHQAMKTPTNYYLFSLAVSD
LLVLLLGMPLEVYEMWRNYPFLFGPVGCYFKTALFETVCFASILSITTVS
VERYVAILHPFRAKLQSTRRRALRILGIVWGFSVLFSLPNTSIHGIKFHY
FPNGSGSATCTVIKPMWIYNFIIQVTSFLFYLLPMTVISVLYYLMALRLK
KDKSLEADEGNANIQRPCRKSVNKMLFVLVLVFAICWAPFHIDRLFFSFV
EEWSESLAAVFNLVHVVSGVFFYLSSAVNPIIYNLLSRRFQAAFQNVISS
FHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w55 Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		E102 E105 N109 F126 E127 N181 H185 C204 Y213 R288 F291 W297 E299 A302 N306 H309 G313
Binding residue
(residue number reindexed from 1)		E61 E64 N68 F85 E86 N140 H144 C160 Y169 R244 F247 W253 E255 A258 N262 H265 G269
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001607 neuromedin U receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0005229 intracellularly calcium-gated chloride channel activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008188 neuropeptide receptor activity
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0042924 neuromedin U binding
GO:0046872 metal ion binding
Biological Process
GO:0002023 reduction of food intake in response to dietary excess
GO:0006940 regulation of smooth muscle contraction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007218 neuropeptide signaling pathway
GO:0007267 cell-cell signaling
GO:0007417 central nervous system development
GO:0007625 grooming behavior
GO:0007631 feeding behavior
GO:0022900 electron transport chain
GO:0048265 response to pain
GO:0050482 arachidonate secretion
GO:0050850 positive regulation of calcium-mediated signaling
GO:1902476 chloride transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w55, PDBe:7w55, PDBj:7w55
PDBsum7w55
PubMed35440625
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
Q9GZQ4|NMUR2_HUMAN Neuromedin-U receptor 2 (Gene Name=NMUR2)

[Back to BioLiP]