Structure of PDB 7vqx Chain R Binding Site BS01

Receptor Information
>7vqx Chain R (length=361) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTV
PCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFY
ILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRA
ISVLVKDDVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVE
GLYLHTLLVAMLPPRRCFLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWD
TNDHSVPWWVIRIPILISIIVNFVLFISIIRILLQKLTSQYKRLAKSTLL
LIPLFGVHYMVFAVFPISISSKYQILFELCLGSFQGLVVAVLYCFLNSEV
QCELKRKWRSR
Ligand information
>7vqx Chain L (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSDGIFTDSYSRYRKQMAVKKYLAAVL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vqx A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
Resolution2.74 Å
Binding residue
(original residue number in PDB)
C25 H28 Q32 F79 F82 Y111 D113 D116 E117 I120 Y123 V126 Y130 K179 Y184 I213 D273 T274 N275 D276 E360 L361
Binding residue
(residue number reindexed from 1)
C2 H5 Q9 F56 F59 Y88 D90 D93 E94 I97 Y100 V103 Y107 K156 Y161 I190 D250 T251 N252 D253 E328 L329
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004999 vasoactive intestinal polypeptide receptor activity
GO:0008528 G protein-coupled peptide receptor activity
GO:0017046 peptide hormone binding
Biological Process
GO:0007165 signal transduction
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007267 cell-cell signaling
GO:0048662 negative regulation of smooth muscle cell proliferation
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7vqx, PDBe:7vqx, PDBj:7vqx
PDBsum7vqx
PubMed35477937
UniProtP41587|VIPR2_HUMAN Vasoactive intestinal polypeptide receptor 2 (Gene Name=VIPR2)

[Back to BioLiP]