Structure of PDB 7vdm Chain R Binding Site BS01

Receptor Information
>7vdm Chain R (length=253) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFLFLCF
QIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSV
LWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQ
TFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLV
FLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFF
VGS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vdm Structure, function and pharmacology of human itch receptor complexes.
Resolution2.98 Å
Binding residue
(original residue number in PDB)		C168 F170 C180 W243 L247
Binding residue
(residue number reindexed from 1)		C137 F139 C149 W212 L216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0042923 neuropeptide binding
GO:1990595 mast cell secretagogue receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0019233 sensory perception of pain
GO:0030431 sleep
GO:0032467 positive regulation of cytokinesis
GO:0043303 mast cell degranulation
GO:0045576 mast cell activation
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vdm, PDBe:7vdm, PDBj:7vdm
PDBsum7vdm
PubMed34789875
UniProtQ96LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 (Gene Name=MRGPRX2)

[Back to BioLiP]