Structure of PDB 7vbi Chain R Binding Site BS01

Receptor Information
>7vbi Chain R (length=382) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEP
GSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECE
ESEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIHLNLFA
SFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQY
CVAANYYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWG
IVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKL
KADIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFT
SFQGLMVAILYCFVNNEVQLEFRKSWERWRLE
Ligand information
>7vbi Chain P (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YGEGTFTSDYSIGLDKIAQKAFVQWLIAG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7vbi Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		V30 S31 T35 W39 E68 P90 W91 R121 L141 Y148 Y152 K197 L201 Y205 W214 Q234 V237 T298 R299 W306 D372 R380 E387
Binding residue
(residue number reindexed from 1)		V3 S4 T8 W12 E41 P63 W64 R94 L106 Y113 Y117 K162 L166 Y170 W179 Q199 V202 T263 R264 W271 D331 R339 E346
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0038023 signaling receptor activity
GO:0044508 glucagon-like peptide 1 receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007190 activation of adenylate cyclase activity
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007611 learning or memory
GO:0008016 regulation of heart contraction
GO:0019933 cAMP-mediated signaling
GO:0031204 post-translational protein targeting to membrane, translocation
GO:0045776 negative regulation of blood pressure
GO:0045777 positive regulation of blood pressure
GO:0046879 hormone secretion
GO:0071377 cellular response to glucagon stimulus
GO:1990911 response to psychosocial stress
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7vbi, PDBe:7vbi, PDBj:7vbi
PDBsum7vbi
PubMed35217653
UniProtP43220|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]