Structure of PDB 7t11 Chain R Binding Site BS01

Receptor Information

>7t11 Chain R (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELF
MLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYL
AVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSS
CTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSVRLLS
GSREKDRNLRKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKG
MFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVL

Ligand information

>7t11 Chain P (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FCFWKTCT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7t11 Plasticity in ligand recognition at somatostatin receptors.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Q102 N186 W188 Y205 I209 F272 P286 F294
Binding residue (residue number reindexed from 1)	Q60 N144 W146 Y163 I167 F230 P244 F252

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0004994	somatostatin receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7t11, PDBe:7t11, PDBj:7t11
PDBsum	7t11
PubMed	35210615
UniProt	P30874\|SSR2_HUMAN Somatostatin receptor type 2 (Gene Name=SSTR2); P41145\|OPRK_HUMAN Kappa-type opioid receptor (Gene Name=OPRK1)

[Back to BioLiP]