Structure of PDB 7s8m Chain R Binding Site BS01

Receptor Information

>7s8m Chain R (length=253) Species: 562,9606

KETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFL
FLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTER
CLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDS
GWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILL
TVLVFLLCGLPFGIQWFLILWIWLFCHIHPVSVVLSSLNSSANPIIYFFV
GSF

Ligand information

>7s8m Chain A (length=5) Species: 9606 (Homo sapiens)

CKNFF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7s8m Structure, function and pharmacology of human itch GPCRs.
• Resolution: 2.54 Å
• Binding residue (original residue number in PDB): N85 C168 D184 W243 F257
• Binding residue (residue number reindexed from 1): N58 C141 D157 W216 F225

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0042923 neuropeptide binding
• GO:0046872 metal ion binding
• GO:1990595 mast cell secretagogue receptor activity

Biological Process

• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0019233 sensory perception of pain
• GO:0022900 electron transport chain
• GO:0030431 sleep
• GO:0032467 positive regulation of cytokinesis
• GO:0043303 mast cell degranulation
• GO:0045576 mast cell activation

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:7s8m, PDBe:7s8m, PDBj:7s8m
• PDBsum: 7s8m
• PubMed: 34789874
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
  Q96LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 (Gene Name=MRGPRX2)