Structure of PDB 7oqb Chain R Binding Site BS01

Receptor Information
>7oqb Chain R (length=173) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFY
NQGDAQYAIKIMNNTVRLYDRLIKVRQVPIAKLFIKNLADSIDSDQLVKI
FNKFGKLIREPEIFYLSKLKCAYVYFEDFEKADLAIKSLNNQLVANNRIT
VDYAFKNGKGNAKYGDDVDRLLN
Ligand information
>7oqb Chain I (length=23) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuacuaagucucauguacuacau
.......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oqb Structural insights into how Prp5 proofreads the pre-mRNA branch site.
Resolution9.0 Å
Binding residue
(original residue number in PDB)		P41 F54 R84
Binding residue
(residue number reindexed from 1)		P33 F46 R76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oqb, PDBe:7oqb, PDBj:7oqb
PDBsum7oqb
PubMed34349264
UniProtQ99181|HSH49_YEAST Protein HSH49 (Gene Name=HSH49)

[Back to BioLiP]