Structure of PDB 7o72 Chain R Binding Site BS01

Receptor Information
>7o72 Chain R (length=261) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVFDGNDIENNETKVYEESLDLDLERSNRQVWLVRLPMFLAEKWRDRNNL
HGQELGKIRINKDGSKITLLLNENDNDSIPHEYDLELTKKVVENEYVFTE
QNLKKYQRDRYIPYVKTIPKKTAIVGTVCHECQVMPSMNDPNYHKIVEQR
RNIVKLNNKERITTLDETVGVTMSHTGMSMRSDNSNFLKVGREKAKSNIK
SIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLV
KYTLRPEYKKL
Ligand information
>7o72 Chain N (length=65) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcacgctgtgtatataatagctatggaacgttcgattcacctccgatgt
gtgttgtacatacat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o72 Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
Resolution3.4 Å
Binding residue
(original residue number in PDB)
N288 K290 S291 I292 R293 P325
Binding residue
(residue number reindexed from 1)
N198 K200 S201 I202 R203 P235
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000993 RNA polymerase II complex binding
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006355 regulation of DNA-templated transcription
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005674 transcription factor TFIIF complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7o72, PDBe:7o72, PDBj:7o72
PDBsum7o72
PubMed34133942
UniProtP41896|T2FB_YEAST Transcription initiation factor IIF subunit beta (Gene Name=TFG2)

[Back to BioLiP]