Structure of PDB 7o3e Chain R Binding Site BS01

Receptor Information
>7o3e Chain R (length=72) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPF
VVVYLIYTWGNQEFEQSKRKNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o3e Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y16 L18 E22 Q23 R24 P27
Binding residue
(residue number reindexed from 1)		Y14 L16 E20 Q21 R22 P25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0021539 subthalamus development
GO:0021548 pons development
GO:0021680 cerebellar Purkinje cell layer development
GO:0021766 hippocampus development
GO:0021794 thalamus development
GO:0021854 hypothalamus development
GO:0021860 pyramidal neuron development
GO:0030901 midbrain development
GO:0045333 cellular respiration
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0045275 respiratory chain complex III

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o3e, PDBe:7o3e, PDBj:7o3e
PDBsum7o3e
PubMed34616041
UniProtQ9CQ69|QCR8_MOUSE Cytochrome b-c1 complex subunit 8 (Gene Name=Uqcrq)

[Back to BioLiP]