Structure of PDB 7nvz Chain R Binding Site BS01

Receptor Information

>7nvz Chain R (length=222) Species: 9606 (Homo sapiens)

AERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGR
TEVSFTLNEDLANEHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAEC
RPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYE
RKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEI
LKEIGVQNVKGIHKNTWELKPE

Ligand information

>7nvz Chain N (length=64)

gaaggggggctataaaagggggtgggggcgcgttcgtcctcactctcttc
cgcatcgctgtctg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nvz Structures of mammalian RNA polymerase II pre-initiation complexes.
• Resolution: 7.2 Å
• Binding residue (original residue number in PDB): K169 K174 R175 R177 P209 G227 I228 H229
• Binding residue (residue number reindexed from 1): K153 K158 R159 R161 P193 G211 I212 H213

Enzymatic activity

• Enzyme Commision number: 3.6.4.12: DNA helicase.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0016251 RNA polymerase II general transcription initiation factor activity

Biological Process

• GO:0006366 transcription by RNA polymerase II
• GO:0006367 transcription initiation at RNA polymerase II promoter
• GO:0006368 transcription elongation by RNA polymerase II
• GO:0045944 positive regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005674 transcription factor TFIIF complex
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:7nvz, PDBe:7nvz, PDBj:7nvz
• PDBsum: 7nvz
• PubMed: 33902107
• UniProt: P13984|T2FB_HUMAN General transcription factor IIF subunit 2 (Gene Name=GTF2F2)