Structure of PDB 7mta Chain R Binding Site BS01

Receptor Information
>7mta Chain R (length=324) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML
GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH
GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE
NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN
ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEV
TRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCG
Ligand information
Ligand IDRET
InChIInChI=1S/C20H28O/c1-16(8-6-9-17(2)13-15-21)11-12-19-18(3)10-7-14-20(19,4)5/h6,8-9,11-13,15H,7,10,14H2,1-5H3/b9-6+,12-11+,16-8+,17-13+
InChIKeyNCYCYZXNIZJOKI-OVSJKPMPSA-N
SMILES
SoftwareSMILES
CACTVS 3.370CC(=C\C=O)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C
ACDLabs 12.01O=C\C=C(\C=C\C=C(\C=C\C1=C(C)CCCC1(C)C)C)C
OpenEye OEToolkits 1.7.0CC1=C(C(CCC1)(C)C)/C=C/C(=C/C=C/C(=C/C=O)/C)/C
OpenEye OEToolkits 1.7.0CC1=C(C(CCC1)(C)C)C=CC(=CC=CC(=CC=O)C)C
CACTVS 3.370CC(=CC=O)C=CC=C(C)C=CC1=C(C)CCCC1(C)C
FormulaC20 H28 O
NameRETINAL
ChEMBLCHEMBL81379
DrugBank
ZINCZINC000004228262
PDB chain7mta Chain R Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7mta Structures of rhodopsin in complex with G-protein-coupled receptor kinase 1.
Resolution4.1 Å
Binding residue
(original residue number in PDB)
A117 I189 Y191 M207 F208 H211 W265 Y268 A269 K296
Binding residue
(residue number reindexed from 1)
A117 I189 Y191 M207 F208 H211 W265 Y268 A269 K296
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0002046 opsin binding
GO:0004930 G protein-coupled receptor activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005502 11-cis retinal binding
GO:0005515 protein binding
GO:0008020 G protein-coupled photoreceptor activity
GO:0008270 zinc ion binding
GO:0009881 photoreceptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007601 visual perception
GO:0007602 phototransduction
GO:0007603 phototransduction, visible light
GO:0009416 response to light stimulus
GO:0009583 detection of light stimulus
GO:0009642 response to light intensity
GO:0010467 gene expression
GO:0016038 absorption of visible light
GO:0016056 G protein-coupled opsin signaling pathway
GO:0043052 thermotaxis
GO:0045494 photoreceptor cell maintenance
GO:0050953 sensory perception of light stimulus
GO:0050960 detection of temperature stimulus involved in thermoception
GO:0060041 retina development in camera-type eye
GO:0071482 cellular response to light stimulus
GO:0071800 podosome assembly
GO:1904389 rod bipolar cell differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0001750 photoreceptor outer segment
GO:0001917 photoreceptor inner segment
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0005911 cell-cell junction
GO:0016020 membrane
GO:0019867 outer membrane
GO:0042622 photoreceptor outer segment membrane
GO:0042995 cell projection
GO:0060342 photoreceptor inner segment membrane
GO:0097225 sperm midpiece
GO:0097381 photoreceptor disc membrane
GO:0097648 G protein-coupled receptor complex
GO:0120200 rod photoreceptor outer segment
GO:1990913 sperm head plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7mta, PDBe:7mta, PDBj:7mta
PDBsum7mta
PubMed34262173
UniProtP02699|OPSD_BOVIN Rhodopsin (Gene Name=RHO)

[Back to BioLiP]