Structure of PDB 7mby Chain R Binding Site BS01

Receptor Information

>7mby Chain R (length=283) Species: 9606 (Homo sapiens)

EWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSD
LMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISL
ERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTK
NNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELY
QLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPIS
FILLLSYTSSCVNPIIYCFMNKRFRLGFMATFP

Ligand information

>7mby Chain P (length=8) Species: 9606 (Homo sapiens)

DYMGWMDF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7mby Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
• Resolution: 2.44 Å
• Binding residue (original residue number in PDB): E38 N98 P101 K105 M121 V125 Y176 R197 R336 E344 S348 I352 L356 Y360
• Binding residue (residue number reindexed from 1): E1 N61 P64 K68 M84 V88 Y139 R160 R233 E241 S245 I249 L253 Y257

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004951 cholecystokinin receptor activity
• GO:0017046 peptide hormone binding
• GO:0042277 peptide binding

Biological Process

• GO:0001764 neuron migration
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
• GO:0007409 axonogenesis
• GO:0030900 forebrain development
• GO:0032870 cellular response to hormone stimulus
• GO:0038188 cholecystokinin signaling pathway
• GO:0046883 regulation of hormone secretion

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:7mby, PDBe:7mby, PDBj:7mby
• PDBsum: 7mby
• PubMed: 34086670
• UniProt: P32238|CCKAR_HUMAN Cholecystokinin receptor type A (Gene Name=CCKAR)