Structure of PDB 7knu Chain R Binding Site BS01

Receptor Information
>7knu Chain R (length=341) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLGVTRNKIMTAQYECYQKIMQYCNRTWDGWLCWNDVAAGTESMQLCPDY
FQDFDPSEKVTKICDNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYL
TIIGHGLSIASLLISLGIFFYFKSLSCQRITLHKNLFFSFVCNSVVTIIH
LTAVANNQALVATNPVSCKVSQFIHLYLMGCNYFWMLCEGIYLHTLIVVA
VFAEKQHLMWYYFLGWGFPLIPACIHAIARSLYYNDNCWISSDTHLLYII
HGPICAALLVNLFFLLNIVRVLITKNLYMKAVRATLILVPLLGIEFVLIP
WEVYDYIMHILMHFQGLLVSTIFCFFNGEVQAILRRNWNQY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7knu Structure and dynamics of the CGRP receptor in apo and peptide-bound forms.
Resolution3.49 Å
Binding residue
(original residue number in PDB)		D70 W72 F92 Q93 D94 H114 S117 W121 T122 Y124 N128
Binding residue
(residue number reindexed from 1)		D29 W31 F51 Q52 D53 H70 S73 W77 T78 Y80 N84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7knu, PDBe:7knu, PDBj:7knu
PDBsum7knu
PubMed33602864
UniProtQ16602|CALRL_HUMAN Calcitonin gene-related peptide type 1 receptor (Gene Name=CALCRL)

[Back to BioLiP]