Structure of PDB 7f8w Chain R Binding Site BS01

Receptor Information
>7f8w Chain R (length=275) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIRITLYAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLA
VACMPFTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLSLVAIALERYS
AICRPLQARVWQTRSHAARVIVATWLLSGLLMVPYPVYTVVQPVGPRVLQ
CVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGLISRELYLGLLAKKR
VVRMLLVIVVLFFLCWLPVYSANTWRAFDGPGAHRALSGAPISFIHLLSY
ASACVNPLVYCFMHRRFRQACLETC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f8w Structures of the human cholecystokinin receptors bound to agonists and antagonists.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		P114 N115 M134 V138 Y189 Q204 V206 H207 R356 H364 I372 H376
Binding residue
(residue number reindexed from 1)		P60 N61 M80 V84 Y135 Q150 V152 H153 R226 H234 I242 H246
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004951 cholecystokinin receptor activity
GO:0005515 protein binding
GO:0015054 gastrin receptor activity
GO:0017046 peptide hormone binding
GO:0031741 type B gastrin/cholecystokinin receptor binding
GO:0046935 1-phosphatidylinositol-3-kinase regulator activity
Biological Process
GO:0001696 gastric acid secretion
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0008284 positive regulation of cell population proliferation
GO:0038188 cholecystokinin signaling pathway
GO:0045851 pH reduction
GO:0048565 digestive tract development
GO:0048732 gland development
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f8w, PDBe:7f8w, PDBj:7f8w
PDBsum7f8w
PubMed34556863
UniProtP32239|GASR_HUMAN Gastrin/cholecystokinin type B receptor (Gene Name=CCKBR)

[Back to BioLiP]