Structure of PDB 7f4i Chain R Binding Site BS01

Receptor Information
>7f4i Chain R (length=266) Species: 562,9606 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEVSISDGLFLSLGLVSLVENALVVATIAKNRNLHSPMYCFICCLALSDL
LVSGSNVLETAVILLLEAGALVARAAVLQQLDNVIDVITCSSMLSSLCFL
GAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFIAYYDH
VAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKLKGAVTLTI
LLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDP
LIYAFHSQELRRTLKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f4i Structural mechanism of calcium-mediated hormone recognition and G beta interaction by the human melanocortin-1 receptor.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F45 E94 T95 I98 D117 D121 C125 M128 Y183 L189 F257 L261 I264 F280 L284
Binding residue
(residue number reindexed from 1)		F10 E59 T60 I63 D82 D86 C90 M93 Y148 L154 F212 L216 I219 F235 L239
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004977 melanocortin receptor activity
GO:0004980 melanocyte-stimulating hormone receptor activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008528 G protein-coupled peptide receptor activity
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0031625 ubiquitin protein ligase binding
GO:0042562 hormone binding
GO:0046872 metal ion binding
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0009650 UV protection
GO:0019222 regulation of metabolic process
GO:0019233 sensory perception of pain
GO:0022900 electron transport chain
GO:0032720 negative regulation of tumor necrosis factor production
GO:0035556 intracellular signal transduction
GO:0042438 melanin biosynthetic process
GO:0043473 pigmentation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060259 regulation of feeding behavior
GO:0070914 UV-damage excision repair
GO:0141163 positive regulation of cAMP/PKA signal transduction
GO:2000253 positive regulation of feeding behavior
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f4i, PDBe:7f4i, PDBj:7f4i
PDBsum7f4i
PubMed34453129
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
Q01726

[Back to BioLiP]