Structure of PDB 7f2o Chain R Binding Site BS01

Receptor Information
>7f2o Chain R (length=287) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WLNTIQPPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADL
ILACGLPFWAITISNNFDWLFGETLCRVVNAIISMNLYSSIWFLMLVSID
RYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDE
GHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQIMQVLRNN
EMQQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGILSSCQDERI
IDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7f2o Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		W113 I137 L141 Y201 E204 A210 C211 V212 I213 Y215 F286 S289 T290 D293 R297 E307 D311 T314 S318 Y322
Binding residue
(residue number reindexed from 1)		W59 I83 L87 Y147 E150 A156 C157 V158 I159 Y161 F227 S230 T231 D234 R238 E248 D252 T255 S259 Y263
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004947 bradykinin receptor activity
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
Biological Process
GO:0006939 smooth muscle contraction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0022900 electron transport chain
GO:0042310 vasoconstriction
Cellular Component
GO:0016020 membrane
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f2o, PDBe:7f2o, PDBj:7f2o
PDBsum7f2o
PubMed34518695
UniProtP30411|BKRB2_HUMAN B2 bradykinin receptor (Gene Name=BDKRB2)

[Back to BioLiP]