Structure of PDB 7euo Chain R Binding Site BS01

Receptor Information
>7euo Chain R (length=295) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVAD
FCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIAL
DRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKT
GTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSY
GLIATKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIREL
LQGMYKEIGIAVDVTSALAFFNSCLNPMLYVFMGQDFRERLIHAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7euo Structural basis for recognition of N-formyl peptides as pathogen-associated molecular patterns.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		D106 L109 F110 R201 R205 Y257 V283
Binding residue
(residue number reindexed from 1)		D85 L88 F89 R180 R184 Y236 V262
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0004875 complement receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004982 N-formyl peptide receptor activity
GO:0005124 scavenger receptor binding
GO:0005515 protein binding
GO:0050786 RAGE receptor binding
Biological Process
GO:0002430 complement receptor mediated signaling pathway
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007263 nitric oxide mediated signal transduction
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030667 secretory granule membrane
GO:0035577 azurophil granule membrane
GO:0101003 ficolin-1-rich granule membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7euo, PDBe:7euo, PDBj:7euo
PDBsum7euo
PubMed36064945
UniProtP21462|FPR1_HUMAN fMet-Leu-Phe receptor (Gene Name=FPR1)

[Back to BioLiP]