Structure of PDB 7eg9 Chain R Binding Site BS01

Receptor Information
>7eg9 Chain R (length=248) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGTMSSSDRAMMNAF
KEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIAC
RQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRF
CSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEK
RTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKLPQL
Ligand information
>7eg9 Chain X (length=71) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agggcgcctataaaagggggtgggggcgcgttcgtcctcagtcgcgatcg
aacactcgagccgagcagacg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7eg9 Structural insights into preinitiation complex assembly on core promoters.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
K189 K196
Binding residue
(residue number reindexed from 1)
K121 K128
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000993 RNA polymerase II complex binding
GO:0003677 DNA binding
GO:0004402 histone acetyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0016407 acetyltransferase activity
GO:0016746 acyltransferase activity
GO:0017025 TBP-class protein binding
GO:0046872 metal ion binding
GO:0046966 nuclear thyroid hormone receptor binding
GO:0061733 peptide-lysine-N-acetyltransferase activity
GO:0140297 DNA-binding transcription factor binding
GO:1990841 promoter-specific chromatin binding
Biological Process
GO:0001174 transcriptional start site selection at RNA polymerase II promoter
GO:0006338 chromatin remodeling
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006473 protein acetylation
GO:0010467 gene expression
GO:0019083 viral transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0051177 meiotic sister chromatid cohesion
GO:0051225 spindle assembly
GO:0051276 chromosome organization
GO:0070897 transcription preinitiation complex assembly
GO:1904798 positive regulation of core promoter binding
GO:1990114 RNA polymerase II core complex assembly
Cellular Component
GO:0000776 kinetochore
GO:0000793 condensed chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005694 chromosome
GO:0016604 nuclear body
GO:0032153 cell division site
GO:0032993 protein-DNA complex
GO:0042585 germinal vesicle
GO:0090575 RNA polymerase II transcription regulator complex
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7eg9, PDBe:7eg9, PDBj:7eg9
PDBsum7eg9
PubMed33795473
UniProtQ00403|TF2B_HUMAN Transcription initiation factor IIB (Gene Name=GTF2B)

[Back to BioLiP]