Structure of PDB 7arc Chain R Binding Site BS01

Receptor Information
>7arc Chain R (length=108) Species: 37502 (Polytomella sp. Pringsheim 198.80) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEKNKIPETVGGAAFKGDLRGTSAVGLGDGLYSHTSKWMQGNGKSPMDYI
NEVEPIKVKGLVVASHGSDDPALGCPVEYISLKGTSYENPAVCKYTGNRY
YSDCWKHG
Ligand information
>7arc Chain q (length=28) Species: 37502 (Polytomella sp. Pringsheim 198.80) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ECYNPKGSWFNPAKRNWKKVEIWQPPQV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7arc A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
Resolution2.88 Å
Binding residue
(original residue number in PDB)		A44 L47 G48 D49 L51 K57 Q60
Binding residue
(residue number reindexed from 1)		A24 L27 G28 D29 L31 K37 Q40
External links