Structure of PDB 6yhs Chain R Binding Site BS01

Receptor Information
>6yhs Chain R (length=96) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFVLNAQARAEDKQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELRELV
KALESNAFFEEVVEIKVGDKVENVKIQALQRHPAKNTPMHADFKRA
Ligand information
>6yhs Chain 5 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6yhs Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R11 Q16 K18 S21 R23 R25 R26 Y35 Q79 Q82 H92
Binding residue
(residue number reindexed from 1)		R9 Q14 K16 S19 R21 R23 R24 Y33 Q77 Q80 H90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yhs, PDBe:6yhs, PDBj:6yhs
PDBsum6yhs
PubMed32857965
UniProtD0C9L7

[Back to BioLiP]