Structure of PDB 6wi9 Chain R Binding Site BS01

Receptor Information

>6wi9 Chain R (length=368) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSS
VPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVND
SSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHM
HLFVSFILRALSNFIKDAVLFRAGCKLVMVLFQYCIMANYSWLLVEGLYL
HTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINA
NASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRL
ARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCF
LNGEVQLEVQKKWQQWHL

Ligand information

>6wi9 Chain P (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HSDGTFTSELSRLREGARLQRLLQGLV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6wi9 Structure and dynamics of the active Gs-coupled human secretin receptor.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	R30 L31 N72 I73 A122 N126 L139 F200 F222 I226 N289 W295 I298 L370 E373
Binding residue (residue number reindexed from 1)	R1 L2 N43 I44 A93 N97 L110 F171 F182 I186 N249 W255 I258 L330 E333

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0004930	G protein-coupled receptor activity

	Biological Process
GO:0007166	cell surface receptor signaling pathway
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6wi9, PDBe:6wi9, PDBj:6wi9
PDBsum	6wi9
PubMed	32811827
UniProt	P47872\|SCTR_HUMAN Secretin receptor (Gene Name=SCTR)

[Back to BioLiP]