Structure of PDB 6qx9 Chain R Binding Site BS01

Receptor Information
>6qx9 Chain R (length=106) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK
Ligand information
>6qx9 Chain 6 (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuggaaaagauuagcauggccccugcgcaaggaugacuucgugaagcgau
uuu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
Resolution3.28 Å
Binding residue
(original residue number in PDB)		D387 R417 S449 R450 P451 K453
Binding residue
(residue number reindexed from 1)		D19 R49 S81 R82 P83 K85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0048025 negative regulation of mRNA splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0046540 U4/U6 x U5 tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtQ9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)

[Back to BioLiP]