Structure of PDB 6qw6 Chain R Binding Site BS01

Receptor Information

>6qw6 Chain R (length=106) Species: 9606 (Homo sapiens)

EDPSLLEWDADDFRIFCGDLGNEVNDDILARAFSRFPSFLKAKVIRDKRT
GKTKGYGFVSFKDPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVR
KKQKEK

Ligand information

>6qw6 Chain 4 (length=125)

agcuuugcgcaguggcaguaucguagccaaugagguuuauccgaggcgcg
auuugcuaauugaaaacuucccaauagccgugacgacuagucggcauugg
caauuuuugacagucucgagacugg

...................<<<<<.<<<.....<<.....>>..>>>>>>
>>........................<<<<<<.<<<<..>>>>.>>>.>>
>.........<<<<<<..>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6qw6 Mechanism of 5' splice site transfer for human spliceosome activation.
• Resolution: 2.92 Å
• Binding residue (original residue number in PDB): D370 W376 F384 G386 D387 I413 F426 K456 S457 M458
• Binding residue (residue number reindexed from 1): D2 W8 F16 G18 D19 I45 F58 K88 S89 M90

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0048025 negative regulation of mRNA splicing, via spliceosome

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0046540 U4/U6 x U5 tri-snRNP complex

External links

• PDB: RCSB:6qw6, PDBe:6qw6, PDBj:6qw6
• PDBsum: 6qw6
• PubMed: 30975767
• UniProt: Q9BTD8|RBM42_HUMAN RNA-binding protein 42 (Gene Name=RBM42)