Structure of PDB 6qno Chain R Binding Site BS01

Receptor Information

>6qno Chain R (length=334) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

CGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLG
FPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHG
YFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGEN
HAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNE
SFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVT
RMVIIYVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSAVY
NPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEAST

Ligand information

Ligand ID

RET

InChI

InChI=1S/C20H28O/c1-16(8-6-9-17(2)13-15-21)11-12-19-18(3)10-7-14-20(19,4)5/h6,8-9,11-13,15H,7,10,14H2,1-5H3/b9-6+,12-11+,16-8+,17-13+

InChIKey

NCYCYZXNIZJOKI-OVSJKPMPSA-N

SMILES

Software	SMILES
CACTVS 3.370	CC(=C\C=O)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C
ACDLabs 12.01	O=C\C=C(\C=C\C=C(\C=C\C1=C(C)CCCC1(C)C)C)C
OpenEye OEToolkits 1.7.0	CC1=C(C(CCC1)(C)C)/C=C/C(=C/C=C/C(=C/C=O)/C)/C
OpenEye OEToolkits 1.7.0	CC1=C(C(CCC1)(C)C)C=CC(=CC=CC(=CC=O)C)C
CACTVS 3.370	CC(=CC=O)C=CC=C(C)C=CC1=C(C)CCCC1(C)C

Formula

C20 H28 O

Name

RETINAL

PDB chain

6qno Chain R Residue 401 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qno Cryo-EM structure of the rhodopsin-G alpha i-beta gamma complex reveals binding of the rhodopsin C-terminal tail to the G beta subunit.
Resolution	4.38 Å
Binding residue (original residue number in PDB)	Y191 M207 F208 W265 Y268 A269 K296
Binding residue (residue number reindexed from 1)	Y190 M206 F207 W264 Y267 A268 K295
Annotation score	4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0002046	opsin binding
GO:0004930	G protein-coupled receptor activity
GO:0005085	guanyl-nucleotide exchange factor activity
GO:0005502	11-cis retinal binding
GO:0005515	protein binding
GO:0008020	G protein-coupled photoreceptor activity
GO:0008270	zinc ion binding
GO:0009881	photoreceptor activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:1990763	arrestin family protein binding

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007601	visual perception
GO:0007602	phototransduction
GO:0007603	phototransduction, visible light
GO:0009416	response to light stimulus
GO:0009583	detection of light stimulus
GO:0009642	response to light intensity
GO:0010467	gene expression
GO:0016038	absorption of visible light
GO:0016056	G protein-coupled opsin signaling pathway
GO:0043052	thermotaxis
GO:0045494	photoreceptor cell maintenance
GO:0050953	sensory perception of light stimulus
GO:0050960	detection of temperature stimulus involved in thermoception
GO:0060041	retina development in camera-type eye
GO:0071482	cellular response to light stimulus
GO:0071800	podosome assembly
GO:1904389	rod bipolar cell differentiation

	Cellular Component
GO:0000139	Golgi membrane
GO:0001750	photoreceptor outer segment
GO:0001917	photoreceptor inner segment
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0005911	cell-cell junction
GO:0016020	membrane
GO:0019867	outer membrane
GO:0042622	photoreceptor outer segment membrane
GO:0042995	cell projection
GO:0060342	photoreceptor inner segment membrane
GO:0097225	sperm midpiece
GO:0097381	photoreceptor disc membrane
GO:0097648	G protein-coupled receptor complex
GO:0120200	rod photoreceptor outer segment
GO:1990913	sperm head plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qno, PDBe:6qno, PDBj:6qno
PDBsum	6qno
PubMed	31251171
UniProt	P02699\|OPSD_BOVIN Rhodopsin (Gene Name=RHO)

[Back to BioLiP]