Structure of PDB 6niy Chain R Binding Site BS01

Receptor Information
>6niy Chain R (length=261) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TPEKLKNAYVLYYLAIVGHSLSIFTLVISLGIFVFFRSLGCQRVTLHKNM
FLTYILNSMIIIIHLVEVVSCKILHFFHQYMMACNYFWMLCEGIYLHTLI
VVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLL
YIIHGPVMAALVVNFFFLLNIVRVLVTKMRETHMYLKAVKATMILVPLLG
IQFVVFPWRPSNKMLGKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVK
RQWAQFKIQWN
Ligand information
>6niy Chain P (length=19) Species: 8025 (Oncorhynchus sp.) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CSNLSTCVLGKLSQELHKL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6niy The Molecular Control of Calcitonin Receptor Signaling.
Resolution3.34 Å
Binding residue
(original residue number in PDB)		L148 H201 L291 V293 E294 L298 Y299 H302 F359 P360 W361 H377
Binding residue
(residue number reindexed from 1)		L11 H64 L143 V145 E146 L150 Y151 H154 F206 P207 W208 H224
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004948 calcitonin receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6niy, PDBe:6niy, PDBj:6niy
PDBsum6niy
PubMed32219215
UniProtP30988|CALCR_HUMAN Calcitonin receptor (Gene Name=CALCR)

[Back to BioLiP]