Structure of PDB 6lpb Chain R Binding Site BS01

Receptor Information
>6lpb Chain R (length=331) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLV
SCPELFRIFNPDQVMGVVSRNCTEDGWSEPFPHYFDACQDYYYLSVKALY
TVGYSTSLVTLTTAMVILCCTRNFIHMNLFVSFMLRAISVFIKDWILYTV
ECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGW
GTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVNFVLF
IGIIVILVQKLQSSIYLRLARSTLLLIPLFGIHYTVFAFNVSKRERLVFE
LGLGSFQGFVVAVLYCFLNGEVQAEIKRKWR
Ligand information
>6lpb Chain P (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HSDGIFTDSYSRYRKQMAVKKYLAAVLG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lpb Cryo-EM structure of the human PAC1 receptor coupled to an engineered heterotrimeric G protein.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		F27 N60 I83 Q146 Y150 K154 Y157 Y161 K206 Y211 V237 D298 L382 E385 L386
Binding residue
(residue number reindexed from 1)		F2 N35 I58 Q89 Y93 K97 Y100 Y104 K143 Y148 V163 D224 L297 E300 L301
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004888 transmembrane signaling receptor activity
GO:0004930 G protein-coupled receptor activity
GO:0004999 vasoactive intestinal polypeptide receptor activity
Biological Process
GO:0007166 cell surface receptor signaling pathway
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lpb, PDBe:6lpb, PDBj:6lpb
PDBsum6lpb
PubMed32157248
UniProtP41586|PACR_HUMAN Pituitary adenylate cyclase-activating polypeptide type I receptor (Gene Name=ADCYAP1R1)

[Back to BioLiP]