Structure of PDB 6id1 Chain R Binding Site BS01

Receptor Information

>6id1 Chain R (length=272) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKI
KYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEK
TRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRV
IRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWK
IPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADR
KAREAVEMRAQVERKMAQKEKE

Ligand information

>6id1 Chain F (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gugcucgcuucggcagcacauauacuaaaauuggaacgauacagagaaga
uuagcauggccccugcgcaaggaugacacgcaaauucgugaagcguu

<<<<<.<<<..>>>>>>>>...............................
......<<...<<<.....>>>....>>...................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6id1 Structures of the human spliceosomes before and after release of the ligated exon.
Resolution	2.86 Å
Binding residue (original residue number in PDB)	K217 I218 P219 N256 K258
Binding residue (residue number reindexed from 1)	K171 I172 P173 N210 K212

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003713	transcription coactivator activity
GO:0003714	transcription corepressor activity
GO:0003723	RNA binding
GO:0005112	Notch binding
GO:0005515	protein binding
GO:0016922	nuclear receptor binding
GO:0019899	enzyme binding
GO:0042809	nuclear vitamin D receptor binding
GO:0042974	nuclear retinoic acid receptor binding
GO:0046332	SMAD binding
GO:0050681	nuclear androgen receptor binding

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0000398	mRNA splicing, via spliceosome
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway
GO:0042771	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:0043923	positive regulation by host of viral transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0048026	positive regulation of mRNA splicing, via spliceosome
GO:0048384	retinoic acid receptor signaling pathway
GO:0048385	regulation of retinoic acid receptor signaling pathway
GO:0050769	positive regulation of neurogenesis
GO:0070562	regulation of vitamin D receptor signaling pathway
GO:0070564	positive regulation of vitamin D receptor signaling pathway
GO:0071300	cellular response to retinoic acid

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0008024	cyclin/CDK positive transcription elongation factor complex
GO:0016363	nuclear matrix
GO:0016604	nuclear body
GO:0016607	nuclear speck
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071013	catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6id1, PDBe:6id1, PDBj:6id1
PDBsum	6id1
PubMed	30728453
UniProt	Q13573\|SNW1_HUMAN SNW domain-containing protein 1 (Gene Name=SNW1)

[Back to BioLiP]