Structure of PDB 6ff7 Chain R Binding Site BS01

Receptor Information
>6ff7 Chain R (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KGEGDLSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERE
RAAAREKNRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKY
IK
Ligand information
>6ff7 Chain 5 (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagauuu
ccguggagaggaacaacucu
.....<<<<<<.<<<........<<<<<<<<...........>>>>>>>>
...>>>.>>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ff7 Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
Resolution4.5 Å
Binding residue
(original residue number in PDB)
P36 S37 H38
Binding residue
(residue number reindexed from 1)
P19 S20 H21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005739 mitochondrion
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ff7, PDBe:6ff7, PDBj:6ff7
PDBsum6ff7
PubMed29361316
UniProtQ9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)

[Back to BioLiP]