Structure of PDB 6dde Chain R Binding Site BS01

Receptor Information

>6dde Chain R (length=281) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALAD
ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVD
RYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGS
IDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRM
LSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQ
TVSWHFCIALGYTNSCLNPVLYAFLDENFKR

Ligand information

>6dde Chain D (length=5) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YAGFA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6dde Structure of the mu-opioid receptor-Giprotein complex.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	Q124 W133 I144 Y148 M151 V236 W318 I322 Y326
Binding residue (residue number reindexed from 1)	Q60 W69 I80 Y84 M87 V172 W254 I258 Y262

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004930	G protein-coupled receptor activity
GO:0004979	beta-endorphin receptor activity
GO:0004985	G protein-coupled opioid receptor activity

	Biological Process
GO:0007186	G protein-coupled receptor signaling pathway

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6dde, PDBe:6dde, PDBj:6dde
PDBsum	6dde
PubMed	29899455
UniProt	P42866\|OPRM_MOUSE Mu-type opioid receptor (Gene Name=Oprm1)

[Back to BioLiP]