Structure of PDB 5zwn Chain R Binding Site BS01

Receptor Information

>5zwn Chain R (length=184) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TRYYCEYCHSYLTHDTLSVRKSHLVGKNHLRITADYYRNKARDIINKHNH
KRRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTS
IDTLKLLYDGSPGYSKVFVDANRFDIGDLVKASKLPQRANSRSRDETCES
NPFPRLNNPKKLEPPKILSQWSNTIPKTSIFYSV

Ligand information

>5zwn Chain G (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaaaaaagguauguauuaa

......................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5zwn Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
Resolution	3.4 Å
Binding residue (original residue number in PDB)	H24 K28 R139 N141
Binding residue (residue number reindexed from 1)	H23 K27 R138 N140

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0008270	zinc ion binding
GO:0030619	U1 snRNA binding
GO:0030627	pre-mRNA 5'-splice site binding
GO:0046872	metal ion binding

	Biological Process
GO:0000387	spliceosomal snRNP assembly
GO:0000395	mRNA 5'-splice site recognition
GO:0000398	mRNA splicing, via spliceosome

	Cellular Component
GO:0000243	commitment complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005685	U1 snRNP
GO:0071004	U2-type prespliceosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5zwn, PDBe:5zwn, PDBj:5zwn
PDBsum	5zwn
PubMed	29794219
UniProt	Q05900\|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)

[Back to BioLiP]