Structure of PDB 5nrl Chain R Binding Site BS01

Receptor Information
>5nrl Chain R (length=173) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFY
NQGDAQYAIKIMNNTVRLYDRLIKVRQVPIAKLFIKNLADSIDSDQLVKI
FNKFGKLIREPEIFYLSKLKCAYVYFEDFEKADLAIKSLNNQLVANNRIT
VDYAFKNGKGNAKYGDDVDRLLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nrl Structure of a pre-catalytic spliceosome.
Resolution7.2 Å
Binding residue
(original residue number in PDB)		Y12 K39 Y52 F54 R84 V86
Binding residue
(residue number reindexed from 1)		Y4 K31 Y44 F46 R76 V78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
PDBsum5nrl
PubMed28530653
UniProtQ99181|HSH49_YEAST Protein HSH49 (Gene Name=HSH49)

[Back to BioLiP]