Structure of PDB 5mqf Chain R Binding Site BS01

Receptor Information

>5mqf Chain R (length=98) Species: 9606 (Homo sapiens)

LSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAR
EKNRRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

Ligand information

>5mqf Chain 5 (length=114)

acucugguuucucuucagaucgcauaaaucuuucgccuuuuacuaaagau
uuccguggagaggaacaacucugagucuuaacccaauuuuuugagccuug
ccuuggcaaggcua

.<<<...<<<<<<<<<<........<<<<<<<<...........>>>>>>
>>...>>>>>>>>>>.......>>>..................<<<<<<<
<....>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5mqf Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
• Resolution: 5.9 Å
• Binding residue (original residue number in PDB): P36 S37 H38 T39
• Binding residue (residue number reindexed from 1): P14 S15 H16 T17

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0045292 mRNA cis splicing, via spliceosome

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005739 mitochondrion
• GO:0016607 nuclear speck
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:5mqf, PDBe:5mqf, PDBj:5mqf
• PDBsum: 5mqf
• PubMed: 28076346
• UniProt: Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)