Structure of PDB 5mps Chain R Binding Site BS01

Receptor Information
>5mps Chain R (length=108) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SYNGIGLKSAKGSSTSGHVQRSLASNNRRRPQGSQQQRQQRQNAIKKASL
AVQKQIETHMEKREIEVQVSELRDRLEEEETLSEEQIDKKCEALRAKLTN
EWQEQQRM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mps Structure of a spliceosome remodelled for exon ligation.
Resolution3.85 Å
Binding residue
(original residue number in PDB)		Y3 T16 S17 H19 V20 R22 R31
Binding residue
(residue number reindexed from 1)		Y2 T15 S16 H18 V19 R21 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mps, PDBe:5mps, PDBj:5mps
PDBsum5mps
PubMed28076345
UniProtQ03375|CWC21_YEAST Pre-mRNA-splicing factor CWC21 (Gene Name=CWC21)

[Back to BioLiP]