Structure of PDB 5lqw Chain R Binding Site BS01

Receptor Information
>5lqw Chain R (length=219) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLEELREYQRRKRTEYEGYLKRNRLDMGQWIRYAQFEIEQHDMRRARSIF
ERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDKLWYK
YLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREI
YSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVAVAKLVNSF
AHWEAAQQRSSALYQIAIE
Ligand information
>5lqw Chain 6 (length=102) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uu
...<<<<<<<.....>>>>>>>............................
..................<<.....>>.......................
..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lqw Molecular architecture of the Saccharomyces cerevisiae activated spliceosome
Resolution5.8 Å
Binding residue
(original residue number in PDB)		R60 Q67 I69 R70 P100 L101
Binding residue
(residue number reindexed from 1)		R22 Q29 I31 R32 P62 L63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003688 DNA replication origin binding
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000354 cis assembly of pre-catalytic spliceosome
GO:0000398 mRNA splicing, via spliceosome
GO:0006270 DNA replication initiation
GO:0006396 RNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0000785 chromatin
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071004 U2-type prespliceosome
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071008 U2-type post-mRNA release spliceosomal complex
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lqw, PDBe:5lqw, PDBj:5lqw
PDBsum5lqw
PubMed27562955
UniProtQ12309|CLF1_YEAST Pre-mRNA-splicing factor CLF1 (Gene Name=CLF1)

[Back to BioLiP]