Structure of PDB 5i2d Chain R Binding Site BS01

Receptor Information
>5i2d Chain R (length=195) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKRFARKETIYLRGEEARTLYRLEEGLVRVVELLPDGRLITLRHVLPGDY
FGEEALEGKAYRYTAEAMTEAVVQGLEPRAMDHEALHRVARNLARQMRRV
QAYEAHLQTGELRARIARYLLFLADTPLSARDRQGIYVTVSHEEIADATA
SIRESVSKVLADLRREGLIATAYRRVYLLDLAALEREAGSALEAA
Ligand information
>5i2d Chain T (length=66) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccttgtgagccacctcacagtcaaggcccgtccgttgccgtataatgg
gagctgtcacggatgc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5i2d Structural basis of transcription activation.
Resolution4.405 Å
Binding residue
(original residue number in PDB)		E111 L112 S151 E154 S155 Y173
Binding residue
(residue number reindexed from 1)		E111 L112 S151 E154 S155 Y173
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5i2d, PDBe:5i2d, PDBj:5i2d
PDBsum5i2d
PubMed27284196
UniProtQ53W63|LDRP_THET8 Transcriptional regulator LdrP (Gene Name=TTHB099)

[Back to BioLiP]