Structure of PDB 4m8b Chain R Binding Site BS01

Receptor Information
>4m8b Chain R (length=181) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSPGPTCYGYIDDEQDLALVFQGVFNGNLRCIERRPYDAEKVELVNPGNI
FVFNEEKSGIKRWTDGFSWSPSRISGKFLVYREYNRLGSHNVPEYNIFER
AHRKYFYTGLLKKTFSLKFNMTDSTKLETFHLIAYYTEKDIHQGSLRRPS
ENPFFHKFRPSQKLLDALQKVAVGNGRSNPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4m8b Structure of a new DNA-binding domain which regulates pathogenesis in a wide variety of fungi.
Resolution2.61 Å
Binding residue
(original residue number in PDB)
R62 W63 S72 L79 V181 G182 N183
Binding residue
(residue number reindexed from 1)
R62 W63 S72 L79 V173 G174 N175
Binding affinityPDBbind-CN: Kd=2.2uM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4m8b, PDBe:4m8b, PDBj:4m8b
PDBsum4m8b
PubMed24994900
UniProtP38867|YHX7_YEAST Uncharacterized protein YHR177W (Gene Name=YHR177W)

[Back to BioLiP]