Structure of PDB 3jxc Chain R Binding Site BS01

Receptor Information
>3jxc Chain R (length=66) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLA
LSKALQCSPDYLLKGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jxc Sequence Recognition of DNA by Protein-Induced Conformational Transitions.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		S31 V33 Q37 W38 T43 E44 P45 N46 N49
Binding residue
(residue number reindexed from 1)		S29 V31 Q35 W36 T41 E42 P43 N44 N47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3jxc, PDBe:3jxc, PDBj:3jxc
PDBsum3jxc
PubMed20053356
UniProtP69202|RPC2_BPP22 Repressor protein C2 (Gene Name=C2)

[Back to BioLiP]