Structure of PDB 3cro Chain R Binding Site BS01

Receptor Information
>3cro Chain R (length=64) Species: 10712 (Phage 434) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQTLSERLKKRRIALKMTQTELATKAGVKQQSIQLIEAGVTKRPRFLFEI
AMALNCDPVWLQYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cro The phage 434 Cro/OR1 complex at 2.5 A resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		T16 Q17 Q28 Q29 Q32
Binding residue
(residue number reindexed from 1)		T18 Q19 Q30 Q31 Q34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3cro, PDBe:3cro, PDBj:3cro
PDBsum3cro
PubMed2038059
UniProtP03036|RCRO_BP434 Regulatory protein cro (Gene Name=CRO)

[Back to BioLiP]