Structure of PDB 2r1j Chain R Binding Site BS01

Receptor Information
>2r1j Chain R (length=66) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLA
LSKALQCSPDYLLKGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2r1j P22 c2 repressor-operator complex: mechanisms of direct and indirect readout
Resolution1.53 Å
Binding residue
(original residue number in PDB)
R11 R20 Q21 N32 V33 S36 R40
Binding residue
(residue number reindexed from 1)
R9 R18 Q19 N30 V31 S34 R38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2r1j, PDBe:2r1j, PDBj:2r1j
PDBsum2r1j
PubMed18237194
UniProtP69202|RPC2_BPP22 Repressor protein C2 (Gene Name=C2)

[Back to BioLiP]