Structure of PDB 8ow1 Chain QQ Binding Site BS01

Receptor Information

>8ow1 Chain QQ (length=247) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PWEFRKVIQAEYRERKIMIGSILRLLETNTVSALDSVFEKYEKEMNQMTH
GDNNEVKRIYSKKERLLEIILTKIKKKLRQAKFPSRISERDLDIEYIYSK
RQFIQNRYSQELQNNERLEAILSREQNLLEETRKLCMNLKTNNKKRLTEK
LIQKDLHPVLNKAMEYTYGLEPDGPVTFRNDSHELNLMLNDPIKSTADVR
LDKEEVLSLLPSLKEYTKKSKELKETMGQMISDSHEEEIKEVFVPHH

Ligand information

>8ow1 Chain D (length=153) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ataagtcacatggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaatattagtgta
tttgatttccgaaagttaaaaaagaaatagtaagaaatatatatttcatt
gaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ow1 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	K156 I157 M158 S225
Binding residue (residue number reindexed from 1)	K16 I17 M18 S85

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003674	molecular_function
GO:0005515	protein binding

	Biological Process
GO:0008608	attachment of spindle microtubules to kinetochore
GO:0051301	cell division
GO:0051321	meiotic cell cycle

	Cellular Component
GO:0000775	chromosome, centromeric region
GO:0000776	kinetochore
GO:0000817	COMA complex
GO:0005634	nucleus
GO:0005694	chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ow1, PDBe:8ow1, PDBj:8ow1
PDBsum	8ow1
PubMed	37506202
UniProt	P53298\|CENPQ_YEAST Inner kinetochore subunit OKP1 (Gene Name=OKP1)

[Back to BioLiP]