Structure of PDB 8iyj Chain Q1 Binding Site BS01

Receptor Information
>8iyj Chain Q1 (length=199) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EATRPSVPSGTLELYFPDHLYRNDYVSLEGPRWAPAIKQAVRWKFTPMGR
DAAGQVWFTGLTNSEPGDAWYKLPRALDTPYREAHTRWHGCFQSRQRGLP
PAYTQHLREMAFWDPAITAQYLNSGPRWGCMQWRDRQIRGKEFVVTRNQF
GAKLPWRSDYVPLLSLPQRPRFTAQDFRQRGLQRPCPAIGQPPPAFTPA
Ligand information
>8iyj Chain X0 (length=25) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LPYQGYESPCSGRHYCLRGMDYCTT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iyj Structures of sperm flagellar doublet microtubules expand the genetic spectrum of male infertility.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
N29 Y31 S33 L34 E35
Binding residue
(residue number reindexed from 1)
N23 Y25 S27 L28 E29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0008150 biological_process
GO:0030317 flagellated sperm motility
Cellular Component
GO:0005575 cellular_component
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005879 axonemal microtubule
GO:0031514 motile cilium
GO:0036126 sperm flagellum
GO:0160111 axonemal A tubule inner sheath

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8iyj, PDBe:8iyj, PDBj:8iyj
PDBsum8iyj
PubMed37295417
UniProtA6H6Q4|TKTI1_MOUSE Tektin bundle-interacting protein 1 (Gene Name=Tektip1)

[Back to BioLiP]