Structure of PDB 9gd2 Chain Q Binding Site BS01

Receptor Information
>9gd2 Chain Q (length=91) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>9gd2 Chain S (length=14) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRFSNRQNKTVNYN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9gd2 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Q44 L103 H106 E110
Binding residue
(residue number reindexed from 1)		Q14 L73 H76 E80
External links
PDB RCSB:9gd2, PDBe:9gd2, PDBj:9gd2
PDBsum9gd2
PubMed39270644
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]